PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010535414.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family MYB_related
Protein Properties Length: 255aa    MW: 28296.7 Da    PI: 7.1465
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010535414.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.21.1e-14132176347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE++l++ + k++G+g+W+ I+r +  +Rt+ q+ s+ qky
   XP_010535414.1 132 PWTEEEHKLFLMGLKKYGKGDWRNISRNFVITRTPTQVASHAQKY 176
                      8*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512938.1722680IPR017884SANT domain
SMARTSM007176.5E-72779IPR001005SANT/Myb domain
CDDcd001671.14E-63076No hitNo description
SuperFamilySSF466891.87E-103085IPR009057Homeodomain-like
PROSITE profilePS5129421.59125181IPR017930Myb domain
SuperFamilySSF466895.83E-17127180IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-17128180IPR006447Myb domain, plants
SMARTSM007173.2E-13129179IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.6E-13129176IPR009057Homeodomain-like
PfamPF002494.1E-13132176IPR001005SANT/Myb domain
CDDcd001677.51E-12132177No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MEILRPTAHV SGGNWILPEE TVKNSSTAAT WTAAENKAFE DALAVYDDDT PDRWQKVAAM  60
IPGKTVGDVI KQYTELEADV INIEAGLVPV PGYITSPFTL DWAGGYNGLK PVGSKRSPAA  120
RPPEHERKKG VPWTEEEHKL FLMGLKKYGK GDWRNISRNF VITRTPTQVA SHAQKYFIRQ  180
LSGGKDKRRA SIHDITTFNL DDHAPLTPSG PIPWSQTFDP NPGFHSHAHH LLGTSNGDHQ  240
NAPFQLYSAY STQVE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A6e-1731961176RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00568DAPTransfer from AT5G58900Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010535414.10.0PREDICTED: transcription factor DIVARICATA isoform X1
SwissprotQ8S9H71e-100DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLV4KWX61e-121V4KWX6_EUTSA; Uncharacterized protein
STRINGBra006741.1-P1e-119(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122827100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58900.11e-119Homeodomain-like transcriptional regulator